Signal Peptide Database - Viruses

 Entry Details
ID   920
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q7T9D9    (Created: 2008-02-05 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   VGP_EBOSU
Protein Name   Envelope glycoprotein
Gene   GP
Organism Scientific   Sudan ebolavirus (strain Uganda-00)
Organism Common   SEBOV
Lineage   Viruses
  ssRNA negative-strand viruses
    Mononegavirales
      Filoviridae
        Ebola-like viruses
Protein Length [aa]   676
Protein Mass [Da]   74594
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   32
chain   Envelope glycoprotein   by similarity   33   676
chain   GP1   by similarity   33   501
chain   GP2   by similarity   502   676
chain   GP2-delta   by similarity   502   637
disulfide bond   Interchain (between GP1 and GP2 chains)   by similarity   53   609
disulfide bond      potential   108   135
disulfide bond      potential   121   147
disulfide bond      potential   511   556
disulfide bond      by similarity   601   608
transmembrane region      potential   651   671
topological domain   Extracellular   potential   33   650
topological domain   Cytoplasmic   potential   672   676
region of interest   Receptor binding   potential   33   185
region of interest   Mucin-like region   by similarity   305   485
region of interest   Fusion peptide   by similarity   524   539
glycosylation site   N-linked (GlcNAc...)   potential   40   40
glycosylation site   N-linked (GlcNAc...)   potential   204   204
glycosylation site   N-linked (GlcNAc...)   potential   208   208
glycosylation site   N-linked (GlcNAc...)   potential   238   238
glycosylation site   N-linked (GlcNAc...)   potential   257   257
glycosylation site   N-linked (GlcNAc...)   potential   268   268
glycosylation site   N-linked (GlcNAc...)   potential   296   296
glycosylation site   N-linked (GlcNAc...)   potential   314   314
glycosylation site   N-linked (GlcNAc...)   potential   366   366
glycosylation site   N-linked (GlcNAc...)   potential   463   463
glycosylation site   N-linked (GlcNAc...)   potential   563   563
glycosylation site   N-linked (GlcNAc...)   potential   618   618
site   Involved in receptor recognition and/or post-binding events   potential   57   57
site   Involved in receptor recognition and/or post-binding events   potential   63   63
site   Involved in receptor recognition and/or post-binding events   potential   88   88
site   Involved in receptor recognition and/or post-binding events   potential   95   95
site   Involved in receptor recognition and/or post-binding events   potential   170   170
site   Cleavage; by host furin   by similarity   501   502
site   Cleavage; by host ADAM17   by similarity   637   638
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   670   670
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   672   672
coiled-coil region      potential   554   595
coiled-coil region      potential   615   634
SP Length   32
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFS
Sequence MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQ
LVCKDH
LASTDQLKSVGLNLEGSGVSTDIPSATKRWGFRSGVPPKVVSYE
AGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHKAQGTGPCPGD
YAFHKDGAFFLYDRLASTV
IYRGVNFAEGVIAFLILAKPKETFLQSPPIR
EAV
NYTENTSSYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTP
QFLFQL
NDTIHLHQQLSNTTGRLIWTLDANINADIGEWAFWENKKNLSEQ
LRGE
ELSFEALSLNETEDDDAASSRITKGRISDRATRKYSDLVPKNSPGM
VPLHIPEGETTLPSQ
NSTEGRRVGVNTQETITETAATIIGTNGNHMQIST
IGIRPSSSQIPSSSPTTAPSPEAQTPTTHTSGPSVMATEEPTTPPGSSPG
PTTEAPTLTTPE
NITTAVKTVLPQESTSNGLITSTVTGILGSLGLRKRSR
RQTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHN
QNA
LVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGT
CRILGPDCCIEPHD
WTKNITDKINQIIHDFIDNPLPNQDNDDNWWTGWRQ
WIPAGIGITGIIIAIIALLCVCKLLC
Original MGGLSLLQLPRDKFRKSSFFVWVIILFQKAFSMPLGVVTNSTLEVTEIDQ
LVCKDHLASTDQLKSVGLNLEGSGVSTDIPSATKRWGFRSGVPPKVVSYE
AGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHKAQGTGPCPGD
YAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKETFLQSPPIR
EAVNYTENTSSYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTP
QFLFQLNDTIHLHQQLSNTTGRLIWTLDANINADIGEWAFWENKKNLSEQ
LRGEELSFEALSLNETEDDDAASSRITKGRISDRATRKYSDLVPKNSPGM
VPLHIPEGETTLPSQNSTEGRRVGVNTQETITETAATIIGTNGNHMQIST
IGIRPSSSQIPSSSPTTAPSPEAQTPTTHTSGPSVMATEEPTTPPGSSPG
PTTEAPTLTTPENITTAVKTVLPQESTSNGLITSTVTGILGSLGLRKRSR
RQTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHN
QNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGT
CRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPNQDNDDNWWTGWRQ
WIPAGIGITGIIIAIIALLCVCKLLC
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11