Signal Peptide Database - Drosophila melanogaster

    

<< < 51 - 100 (of 654)> >>
Accession NumberEntry NameProtein NameOrganismLengthSP StatusSignal Sequence
P40141 NG4_DROME Protein new-glue 4 Drosophila melanogaster 16 potential MEWKLLLIVLPWLLVC
P54185 OBA5_DROME Putative odorant-binding protein A5 Drosophila melanogaster 19 potential MKLPALHLLFLGFICLARS
Q9V5E1 PAL1_DROME Peptidyl-alpha-hydroxyglycine alpha-amidating lyase 1 Drosophila melanogaster 33 potential MKSTDSAKCLGSKSLAICCLLLHLLLCIRP...
Q9VMR8 TOTM_DROME Protein Turandot M Drosophila melanogaster 23 potential MNPTIYLSCLMVFSVFLLGKVNA
Q23835 AMY1_DROAN Alpha-amylase 1 Drosophila ananassae 18 potential MFLAKSIVCLALLAVANA
O76263 AMYR_DROWI Alpha-amylase-related protein Drosophila willistoni 18 by similarity MRLSLSVLLCLGLALTLA
Q8WSV2 ANDP_DROSE Andropin Drosophila sechellia 23 potential MKYFVVLVVLALILAITVDPSDA
P45884 ATTA_DROME Attacin-A Drosophila melanogaster 20 potential MQKTSILIVALVALFAITEA
P84223 CECC_DROOR Cecropin-C Drosophila orena 23 by similarity MNFNKIFVFVALILAISLGQSEA
Q9VN93 CPR1_DROME Putative cysteine proteinase CG12163 Drosophila melanogaster 20 potential MRLFAAATVALVLLLGQAAG
B2ZBA1 DSK_DROYA Drosulfakinins Drosophila yakuba 31 potential MGLRSCTHFATLVIPLWALAFCFLVVVPVP...
O16171 EST5C_DROPE Esterase-5C Drosophila persimilis 19 potential MLAARLIILLSFYWLSASA
Q9VSL7 FOI_DROME Zinc transporter foi Drosophila melanogaster 21 potential MARHIMAVCVVCLLCAHRLHC
Q09101 HIG_DROME Locomotion-related protein Hikaru genki Drosophila melanogaster 30 potential MWSRQRMRHKPLWALISLTVLLLVLDKSNA
Q8MX32 IDGF3_DROSI Chitinase-like protein Idgf3 Drosophila simulans 23 by similarity MSGSLWLSLALSLAVLAQFKVSA
Q9VT53 INSL4_DROME Probable insulin-like peptide 4 Drosophila melanogaster 26 potential MSLIRLGLALLLLLATVSQLLQPVQG
P33740 MS2B_DROSI Accessory gland-specific peptide 26Ab Drosophila simulans 21 potential MNYFAVLCIFSCICFWQFSDA
Q9W0R6 MTH9_DROME Probable G-protein coupled receptor Mth-like 9 Drosophila melanogaster 19 potential MVSPLIILLIIWLSVGAKS
O97148 MTH_DROME G-protein coupled receptor Mth Drosophila melanogaster 24 confirmed MKTLLVLRISTVILVVLVIQKSYA
Q23982 PEB2_DROME Ejaculatory bulb-specific protein 2 Drosophila melanogaster 20 potential MIRILVLMITFTLMTGSALC
P13729 SGS3_DROSI Salivary glue protein Sgs-3 Drosophila simulans 23 confirmed MKLTIATVLASILLIGFANVANC
Q9VWH8 TM167_DROME Transmembrane protein 167 homolog Drosophila melanogaster 28 potential MLPSALFNFHSLLSVILLLICTCAYLRS
B4R1Q5 TOTA2_DROSI Protein Turandot A2 Drosophila simulans 21 potential MNSSTSLMCFALLLISPLCMG
B4R1P9 TOTX_DROSI Protein Turandot X Drosophila simulans 22 potential MGLHIGSLLICVFLGILPFATA
O18345 AMY2_DROAN Alpha-amylase 2 Drosophila ananassae 18 potential MFLAKSIVCLALLAVANA
O76265 AMYR_DROER Alpha-amylase-related protein Drosophila erecta 19 by similarity MFKLAFTLTLCLAGGLSLA
Q9XZ63 ARMET_DROME ARMET-like protein Drosophila melanogaster 22 potential MKTWYMVVVIGFLATLAQTSLA
Q9NHA8 BGBP3_DROME Gram-negative bacteria-binding protein 3 Drosophila melanogaster 25 potential MADALRFVAWSCCLQLLFLLLGVQG
P07185 CH15_DROME Chorion protein S15 Drosophila melanogaster 18 potential MKYLIVCVTLALFAYINA
Q9W092 CHIT2_DROME Probable chitinase 2 Drosophila melanogaster 33 potential MTLRSRLSGEAPQLWLLLLLASTASSLWAS...
P56674 HH_DROHY Protein hedgehog Drosophila hydei 31 potential MRHIAHTPRGSCFMALLLLLLLALNFRHAH...
P07188 LCP3_DROME Larval cuticle protein 3 Drosophila melanogaster 16 confirmed MFKILLVCSLAALVAA
Q8MKK0 OB57A_DROME General odorant-binding protein 57a Drosophila melanogaster 20 potential MFNTRLAIFLLLIVVSLSQA
P54195 PBP5_DROME Pheromone-binding protein-related protein 5 Drosophila melanogaster 21 potential MQSTPIILVAIVLLGAALVRA
Q7K0P4 PGAP3_DROME Post-GPI attachment to proteins factor 3 Drosophila melanogaster 22 potential MSSRSLSAIVLLLGALVTACLA
P35992 PTP10_DROME Tyrosine-protein phosphatase 10D Drosophila melanogaster 42 potential MLYQLSKATTRIRLKRQKAVPQHRWLWSLA...
Q04164 SAS_DROME Putative epidermal cell surface receptor Drosophila melanogaster 41 potential MQTCRRRKASGGQSTIKWSRMCLATLCGLL...
Q8INV7 TOTE_DROME Protein Turandot E Drosophila melanogaster 38 potential MSNTRTVHSSTSISKMNSALQISCLLVVLG...
P06607 VIT3_DROME Vitellogenin-3 Drosophila melanogaster 19 confirmed MMSLRICLLATCLLVAAHA
Q9VLJ6 ACER_DROME Angiotensin-converting enzyme-related protein Drosophila melanogaster 22 potential MGACNITVLLLVIMLWLPHGLS
Q24049 AMN_DROME Amnesiac neuropeptides Drosophila melanogaster 32 potential MRSFCCCFYPAAVALHCVLLFYTFFLLFRA...
O77018 AMYR_DROTK Alpha-amylase-related protein Drosophila takahashii 19 by similarity MFKFALALTLCLAGSLSLA
P21663 ANDP_DROME Andropin Drosophila melanogaster 23 potential MKYFVVLVVLALILAISVGPSDA
O61272 CECA1_DROSI Cecropin-A1 Drosophila simulans 19 potential MNFYNIFVFVALILAITIG
P84019 CECC_DROMA Cecropin-C Drosophila mauritiana 23 confirmed MNFYKIFVFVALILAISIGQSEA
P24516 CH19_DROVI Chorion protein S19 Drosophila virilis 16 potential MNKFATLAVFISVCLA
Q5W1L5 CORZ_DROSI Pro-corazonin Drosophila simulans 19 by similarity MLRLLLLPLFLFTLSMCMG
B2ZB99 DSK_DROSI Drosulfakinins Drosophila simulans 31 potential MGLRSCTHLATLFMTLWALAFCFLVVVPIP...
P25726 EST5B_DROPS Esterase-5B Drosophila pseudoobscura pseudoobscura 19 potential MYCAKLILLLGCFWISSSA
P34082 FAS2_DROME Fasciclin-2 Drosophila melanogaster 28 potential MGELPPNSVGVFLALLLCSCSLIELTRA
<< < 51 - 100 (of 654)> >>

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11