Signal Peptide Database - Drosophila melanogaster


<< < 1 - 50 (von 654)> >>
Accession NumberEntry NameProtein NameOrganismLengthSP StatusSignal Sequence
P17644 ACH2_DROME Acetylcholine receptor subunit alpha-like 2 Drosophila melanogaster 21 probable MAPGCCTTRPRPIALLAHIWR
O76264 AMYR_DROYA Alpha-amylase-related protein Drosophila yakuba 19 by similarity MFKLALTLTLCLAGSLSLA
Q8WSV4 ANDP_DROSI Andropin Drosophila simulans 23 potential MKYFVVLVVLALILAIAVGPSDA
Q9VL86 CBPA1_DROME Zinc carboxypeptidase A 1 Drosophila melanogaster 22 potential MSLNKCLLFALLAIVASASVSA
P84020 CECC_DROSE Cecropin-C Drosophila sechellia 23 confirmed MNFYKIFVFVALILAISIGQSEA
Q9NIP6 CP2B_DROME Cardio acceleratory peptide 2b Drosophila melanogaster 21 potential MKSMLVHIVLVIFIIAEFSTA
P25725 EST5C_DROPS Esterase-5C Drosophila pseudoobscura pseudoobscura 19 potential MLAARLIILLSFYWLSASA
P33438 GLT_DROME Glutactin Drosophila melanogaster 17 confirmed MKPLLLVLALCGAQVHA
Q08180 ICCR_DROME Irregular chiasm C-roughest protein Drosophila melanogaster 19 potential MLHTMQLLLLATIVGMVRS
Q8MX31 IDGF3_DROYA Chitinase-like protein Idgf3 Drosophila yakuba 23 by similarity MTGSLWLSLALSLAVLAQFKVSA
Q24247 ITA1_DROME Integrin alpha-PS1 Drosophila melanogaster 30 potential MLELPFTTIRPNCRLRQNLGILIILQCVLT
P29615 LYSP_DROME Lysozyme P Drosophila melanogaster 18 potential MKAFLVICALTLTAVATQ
P07190 MAL2_DROME Probable maltase H Drosophila melanogaster 19 potential MRPQSAACLLLAIVGFVGA
P83120 MTH_DROSI G-protein coupled receptor Mth Drosophila simulans 24 by similarity MKTLFVLRISTVILVVLVIQKSYA
Q9W1C9 PEB3_DROME Ejaculatory bulb-specific protein 3 Drosophila melanogaster 17 potential MKMILALVVLGLVLVAA
Q9VEG6 PERC_DROME Chorion peroxidase Drosophila melanogaster 21 potential MSRILFILLLLIVTQLSELQA
Q70PY2 PGSB1_DROME Peptidoglycan-recognition protein-SB1 Drosophila melanogaster 24 potential MNTSTAISFVAALVLCCLALSANA
Q868Z9 PPN_DROME Papilin Drosophila melanogaster 26 confirmed MDLSRRLCSTALVAFIVLASIHDSQS
P54631 SCW_DROME Protein screw Drosophila melanogaster 16 potential MLNVFFLTSLFYAASA
P13728 SGS3_DROYA Salivary glue protein Sgs-3 Drosophila yakuba 23 confirmed MKLTIAISLASILLLSVAHVAQG
Q8IN44 TOTA_DROME Protein Turandot A Drosophila melanogaster 21 potential MNSSTALMCFALLLISPLCMG
B4IUQ9 TOTX_DROYA Protein Turandot X Drosophila yakuba 22 potential MQFYITSLLICVLLGIVRFASA
P67807 A70A_DROSI Accessory gland-specific peptide 70A Drosophila simulans 19 by similarity MKTLSLFLVLVCLLGLVQS
P08144 AMYA_DROME Alpha-amylase A Drosophila melanogaster 18 confirmed MFLAKSIVCLALLAVANA
O77019 AMYR_DROBA Alpha-amylase-related protein Drosophila bakoue 20 by similarity MIKFALALTLCLAGASLSLA
P22815 BOSS_DROME Protein bride of sevenless Drosophila melanogaster 31 potential MKVMDALQSGRRKPLPVALLCILVTVFCVL...
P10040 CRB_DROME Protein crumbs Drosophila melanogaster 88 confirmed MAKIANASLSQQQKQRQAETATTTTTTVAA...
P27779 CUP7_DROME Pupal cuticle protein Edg-78E Drosophila melanogaster 16 potential MYKYLFCLALIGCACA
P16369 CUPP_DROPS Pupal cuticle protein Drosophila pseudoobscura pseudoobscura 15 potential MHLLMSLFGVLAVMQ
Q23933 DEC1_DROER Defective chorion-1 protein Drosophila erecta 21 potential MRLYSHLPLLALLVVQAVGQS
Q9VLK4 DIUX_DROME Diuretic hormone class 2 Drosophila melanogaster 25 potential MTNRCACFALAFLLFCLLAISSIEA
P83869 IM14_DROME Immune-induced peptide 14 Drosophila melanogaster 22 confirmed MNCLKICGFFFALIAALATAEA
Q9W4Z4 INSL6_DROME Probable insulin-like peptide 6 Drosophila melanogaster 33 potential MVLKVPTSKVLLVLATLFAVAAMISSWMPQ...
Q7JZV0 LCP2A_DROME Larval cuticle protein 2A Drosophila melanogaster 16 confirmed MKFFIAFACLLAVALA
P83972 LYSD_DROME Lysozyme D Drosophila melanogaster 18 by similarity MKAFIVLVALACAAPAFG
P83119 MTH12_DROME Probable G-protein coupled receptor Mth-like 12 Drosophila melanogaster 17 potential MFLWLKCFCTLIIVTIA
Q24395 MTK_DROME Metchnikowin Drosophila melanogaster 24 potential MQLNLGAIFLALLGVMATATSVLA
Q9V4A7 PLXB_DROME Plexin-B Drosophila melanogaster 33 potential MLRKELYCANIIHVLHVLCIIIILGSQHYC...
Q29AU6 RUMI_DROPS O-glucosyltransferase rumi Drosophila pseudoobscura pseudoobscura 20 potential MLINVVLIILLVGLNGKASG
P02841 SGS7_DROME Salivary glue protein Sgs-7 Drosophila melanogaster 23 confirmed MKLIAVTIIACILLIGFSDLALG
B4R1Q2 TOTB_DROSI Protein Turandot B Drosophila simulans 21 potential MNFKTALICFALLLIGTLCSA
P54626 TRYDG_DROER Trypsin delta/gamma Drosophila erecta 22 probable MLKFVILLSAVACALGGTIPEG
O44342 WBL_DROME Protein windbeutel Drosophila melanogaster 21 potential MMHILVTLLLVAIHSIPTTWA
Q9VFX1 WNT8_DROME Wnt inhibitor of Dorsal protein Drosophila melanogaster 16 potential MIFAITFFMGITSTLA
P62407 YELL_DROSI Protein yellow Drosophila simulans 21 potential MFQDKGWILVTLITLVTPSWA
O18552 AMYR_DROPS Alpha-amylase-related protein Drosophila pseudoobscura pseudoobscura 20 by similarity MFKFTFALALCVLAAGLVLA
Q9VBW3 CAD96_DROME Tyrosine kinase receptor Cad96Ca Drosophila melanogaster 48 potential MVYHHHNHESRIIHCRKQLTSWRRRSLLLT...
P07184 CH18_DROME Chorion protein S18 Drosophila melanogaster 17 potential MMKFMCICLCAISAVSA
Q8SXT3 HFW2_DROME Protein singed wings 2 Drosophila melanogaster 29 potential MPSGVFQKRPKAAETISLFCMILIRLSRA
P11997 LSP1G_DROME Larval serum protein 1 gamma chain Drosophila melanogaster 16 potential MKLTLVILALVACVTA
<< < 1 - 50 (von 654)> >>

© 2007-2017 Katja Kapp, Dresden & e. K., Dresden, Germany, last update 2010-06-11